concerncautioncontentmentsatisfactiondeterminationcarecommitmentadvocacysmoking cessationalcohol consumptionmental healthphysical healthsleepwalkingself-carefamily carepreventative healthdietsmoking cessationmoderate alcohol consumptionsufficient sleepvitamin D intakephysical activityyogacold therapybreathing exercisesgardeningskin carecommunity involvementpreventative healthbalanced diethealthy weightskin

Winter Wellness and Self-Care

An insightful discussion on maintaining physical and mental health during winter, with a focus on self-care, diet, and community involvement.

More from this author:

Hammersmith And Fulham

https://health-shared.com/journeys/sglt-2-inhibitor-0342?v=what-is-type-1-diabetes-0972

SGLT-2 Inhibitor

Learning

Dr. Sheharyar Quraishi discusses Type 1 Diabetes, its relationship with insulin, age of onset, and impact on the pancreas gland. Donna van Zyl contrasts Type 2 Diabetes with Type 1...

Treatment

Dr. Sheharyar Quraishi, Consultant Endocrinologist and Diabetologist, discusses the use of SGLT-2 inhibitors, their benefits for people with diabetes, coronary artery disease, and ...

Continuing Care

Dr. Sheharyar Quraishi, Consultant Endocrinologist, discusses the importance of routine tests when starting on SGLT-2 inhibitors, emphasizing the need for blood pressure monitoring...

Hammersmith And Fulham

https://health-shared.com/stories/managing-diabetes-in-the-heat-510944203

Managing Diabetes in the Heat

Hammersmith And Fulham

The interviewee shares their personal experiences with managing diabetes, particularly during the summer months. They discuss their dietary habits, activity levels, and the challenges they face with their condition when the weather is hot. The conversation also touches on their strategies for maintaining their health and wellbeing despite these challenges.

Hammersmith And Fulham

https://health-shared.com/stories/embracing-summer-wellness-215280114

Embracing Summer Wellness

Hammersmith And Fulham

In this interview, the individual shares their enthusiasm for the upcoming summer season, highlighting their plans for holidays, increased exercise, and strategies for coping with longer days. They discuss their unchanged diet, love for rice and curry, and the addition of ice cream during the warmer months. The interviewee also touches on their approach to stress management and their passion for watching sports on television.

Hammersmith And Fulham

https://health-shared.com/journeys/glp-1-agonist-medicines-diabetes-0641?v=benefits-of-glp-1-agonist-medicines-in-diabetes-0000

GLP-1 Agonist Medicines - Diabetes

Learning

Dr. Sheharyar Quraishi discusses Type 1 Diabetes, its relationship with insulin, age of onset, and impact on the pancreas. Donna van Zyl distinguishes Type 2 Diabetes from Type 1

Treatment

GLP-1 agonists are effective for weight loss in non-diabetic obese individuals. Dr. Qureshi explains how they work in diabetes management and their potential benefits and side effe...

Continuing Care

GLP-1 receptor agonists can lead to gastrointestinal side effects. Mr. Ahmed Ahmed discusses the potential unwelcome side effects of using GLP-1 agonists in a video.

Hammersmith And Fulham

https://health-shared.com/journeys/endoscopic-gastric-sleeve-for-weight-loss-journey-0830?v=what-are-the-potential-complications-of-an-endosdcopic-sleeve-0843

Endoscopic gastric sleeve for weight loss journey

Learning

Endoscopic Sleeve Gastroplasty (ESG) is a minimally invasive weight-loss procedure that reduces BMI and metabolic complications in obese patients. It involves using a suturing devi...

Treatment

Endoscopic sleeve gastroplasty (ESG) is a minimally invasive weight-loss surgery that can lead to complications such as bleeding, leaks, pulmonary embolism, ulcers, gastric reflux ...

Continuing Care

Endoscopic sleeve gastroplasty (ESG) is a successful non-surgical weight loss technique, resulting in an average 20% total body weight decrease within a year. Individual results ma...