concerncautioncontentmentsatisfactiondeterminationcarecommitmentadvocacysmoking cessationalcohol consumptionmental healthphysical healthsleepwalkingself-carefamily carepreventative healthdietsmoking cessationmoderate alcohol consumptionsufficient sleepvitamin D intakephysical activityyogacold therapybreathing exercisesgardeningskin carecommunity involvementpreventative healthbalanced diethealthy weightskin

Winter Wellness and Self-Care

An insightful discussion on maintaining physical and mental health during winter, with a focus on self-care, diet, and community involvement.

More from this author:

Hammersmith And Fulham

https://health-shared.com/journeys/glp1-agonists-for-weight-loss-journey-0150?v=use-of-multi-disciplinary-team-mdt-approach-in-field-of-0186

GLP1 agonists for weight loss journey

Learning

GLP-1 agonists like semaglutide and liraglutide are effective for weight loss in non-diabetic obese individuals. Mr. Ahmed Ahmed discusses the types of GLP-1 agonists available and...

Treatment

Multidisciplinary team (MDT) meetings are recommended for bariatric surgery patients. Mr. Ahmed Ahmed discusses the MDT approach and various surgical procedures for achieving signi...

Continuing Care

GLP-1 receptor agonists may cause gastrointestinal side effects. Weight loss advantage disappears after stopping the drug, and long-term use is recommended for metabolic health ben...

Hammersmith And Fulham

https://health-shared.com/journeys/continuous-glucose-monitoring-0266?v=do-you-need-to-have-an-operation-to-have-an-insulin-pump-fitted-1554574099165

Continuous Glucose Monitoring

Learning

Dr. Sheharyar Quraishi, Consultant Endocrinologist and Diabetologist explains Type 1 Diabetes, its symptoms, causes, diagnosis, complications, and routine tests for management in c...

Treatment

Dr. Sheharyar Quraishi, Consultant Endocrinologist, discusses eligibility for insulin pump therapy under the UK NHS, including screening tests and factors considered. He also talks...

Continuing Care

Dr. Sheharyar Quraishi, Consultant Endocrinologist, discusses the daily routine and lifespan of insulin pumps, providing insight into what to expect when using this diabetes manage...

Hammersmith And Fulham

https://health-shared.com/journeys/gastric-balloon-for-weight-loss-journey-0029?v=who-is-a-gastric-balloon-suitable-for-0906

Gastric balloon for weight loss journey

Learning

Gastric balloons are temporary medical devices inserted in the stomach to aid weight loss. They are suitable for individuals with a BMI of 30-40 and require commitment to lifestyle...

Treatment

Gastric balloons may lead to complications such as blockage, overinflation, acute pancreatitis, ulcers, or perforation. Removal is done using an endoscope and recovery involves a l...

Continuing Care

After the removal of a gastric balloon, patients can consider a second bariatric treatment such as gastric sleeve or Lap-Band. Mr. Ahmed Ahmed discusses the possibility of bariatri...

Hammersmith And Fulham

https://health-shared.com/journeys/psychological-optimisation-journey-for-weight-loss-surgery-0103?v=how-can-i-get-reassurance-and-support-for-my-weight-loss-surgery-0177

Psychological Optimisation journey for weight loss surgery

Learning

Mr. Ahmed Ahmed discusses the importance of psychological preparedness for surgery to reduce anxiety and prevent negative postoperative outcomes.

Treatment

Mr. Ahmed Ahmed emphasizes the importance of a strong support network for weight loss surgery. He also discusses the role of healthcare professionals in providing psychological sup...

Continuing Care

Mr. Ahmed Ahmed advises continuing psychological support during the rehabilitation period after bariatric surgery to help cope with physical and eating changes.

Hammersmith And Fulham

https://health-shared.com/journeys/endoscopic-gastric-sleeve-for-weight-loss-journey-0830?v=what-are-the-potential-complications-of-an-endosdcopic-sleeve-0843

Endoscopic gastric sleeve for weight loss journey

Learning

Endoscopic Sleeve Gastroplasty (ESG) is a minimally invasive weight-loss procedure that reduces BMI and metabolic complications in obese patients. It involves using a suturing devi...

Treatment

Endoscopic sleeve gastroplasty (ESG) is a minimally invasive weight-loss surgery that can lead to complications such as bleeding, leaks, pulmonary embolism, ulcers, gastric reflux ...

Continuing Care

Endoscopic sleeve gastroplasty (ESG) is a successful non-surgical weight loss technique, resulting in an average 20% total body weight decrease within a year. Individual results ma...