Health Shared Logo whiteHealth Shared Logo dark
Winter Wellness and Self-Care
concerncautioncontentmentsatisfactiondeterminationcarecommitmentadvocacysmoking cessationalcohol consumptionmental healthphysical healthsleepwalkingself-carefamily carepreventative healthdietsmoking cessationmoderate alcohol consumptionsufficient sleepvitamin D intakephysical activityyogacold therapybreathing exercisesgardeningskin carecommunity involvementpreventative healthbalanced diethealthy weightskin

Winter Wellness and Self-Care

An insightful discussion on maintaining physical and mental health during winter, with a focus on self-care, diet, and community involvement.


More from this author:

SGLT-2 Inhibitor

Learning

Dr. Sheharyar Quraishi discusses Type 1 Diabetes, its relationship with insulin, age of onset, and impact on the pancreas gland. Donna van Zyl contrasts Type 2 Diabetes with Type 1...

Treatment

Dr. Sheharyar Quraishi, Consultant Endocrinologist and Diabetologist, discusses the use of SGLT-2 inhibitors, their benefits for people with diabetes, coronary artery disease, and ...

Continuing Care

Dr. Sheharyar Quraishi, Consultant Endocrinologist, discusses the importance of routine tests when starting on SGLT-2 inhibitors, emphasizing the need for blood pressure monitoring...

GLP-1 Agonist Medicines - Diabetes

Learning

Dr. Sheharyar Quraishi discusses Type 1 Diabetes, its relationship with insulin, age of onset, and impact on the pancreas. Donna van Zyl distinguishes Type 2 Diabetes from Type 1

Treatment

GLP-1 agonists are effective for weight loss in non-diabetic obese individuals. Dr. Qureshi explains how they work in diabetes management and their potential benefits and side effe...

Continuing Care

GLP-1 receptor agonists can lead to gastrointestinal side effects. Mr. Ahmed Ahmed discusses the potential unwelcome side effects of using GLP-1 agonists in a video.

Endoscopic gastric sleeve for weight loss journey

Learning

Endoscopic Sleeve Gastroplasty (ESG) is a minimally invasive weight-loss procedure that reduces BMI and metabolic complications in obese patients. It involves using a suturing devi...

Treatment

Endoscopic sleeve gastroplasty (ESG) is a minimally invasive weight-loss surgery that can lead to complications such as bleeding, leaks, pulmonary embolism, ulcers, gastric reflux ...

Continuing Care

Endoscopic sleeve gastroplasty (ESG) is a successful non-surgical weight loss technique, resulting in an average 20% total body weight decrease within a year. Individual results ma...